Protein Info for CSW01_07625 in Vibrio cholerae E7946 ATCC 55056

Annotation: sulfurtransferase FdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00129: formate dehydrogenase family accessory protein FdhD
  • amino acids 32 to 265 (234 residues), 141 bits, E=2.1e-45
• PF02634: FdhD-NarQ
  • amino acids 34 to 266 (233 residues), 266 bits, E=1.8e-83

Best Hits

KEGG orthology group: K02379, FdhD protein (inferred from 100% identity to vch:VC1519)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)
• superpathway of C1 compounds oxidation to CO₂ (2/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Protein Sequence (277 amino acids)

>CSW01_07625 sulfurtransferase FdhD (Vibrio cholerae E7946 ATCC 55056)
MAKPSIIKTSENPLQTIEVEVYDEYGEKLVKSIACERPLTVLLNWKEIVTLMTLGSRPEA
LVLGYLKNQSFISDPEALDSIIIDWETHSAAVVTRENIDHLEPALKKKTVTSGCGQGTMY
GNVMKQLEHYQVPQQPIKQSQIYAALEALTHYNDTYKKAGAVHGCAICQEDRVLSFVEDV
GRHNAVDTLAGEMWLNGMRGDDKIFYTTGRLTSEMVIKVAQMGIPVLLSRSGVTQMGLEL
AQRFGITTIARASGRRFHVYSGADKMVFDVKGHSEEA