Protein Info for CSW01_07525 in Vibrio cholerae E7946 ATCC 55056

Annotation: Free methionine-(R)-sulfoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF01590: GAF" amino acids 72 to 181 (110 residues), 30.6 bits, see alignment E=4.4e-11 PF13185: GAF_2" amino acids 79 to 182 (104 residues), 38.2 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: K07170, GAF domain-containing protein (inferred from 100% identity to vcm:VCM66_1441)

Predicted SEED Role

"Free methionine-(R)-sulfoxide reductase, contains GAF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>CSW01_07525 Free methionine-(R)-sulfoxide reductase (Vibrio cholerae E7946 ATCC 55056)
MSLKYVILMRMHPILVMRIVRSSRSEVFIFQMEVIMNLEQYQRLTKQAVALLEGETNLIA
NLANLSALLNMELTELNWVGFYLMQENELVLGPFQGKPACVRIPVGRGVCGTAVAENKVQ
RVYDVHQFEGHIACDAASNSEIVIPFSINGKVAGVLDIDSPNIGRFSEIDEQGLTYLMSE
VEKLLNSQANKA