Protein Info for CSW01_07470 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 PF00005: ABC_tran" amino acids 19 to 185 (167 residues), 86 bits, see alignment E=2.8e-27 amino acids 336 to 469 (134 residues), 96.4 bits, see alignment E=1.7e-30 PF12848: ABC_tran_Xtn" amino acids 224 to 298 (75 residues), 42.5 bits, see alignment E=4.1e-14 PF16326: ABC_tran_CTD" amino acids 564 to 632 (69 residues), 76.9 bits, see alignment E=8.1e-25

Best Hits

Swiss-Prot: 64% identical to UUP_ECOLI: ABC transporter ATP-binding protein uup (uup) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to vch:VC1486)

Predicted SEED Role

"ABC transporter ATP-binding protein uup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (639 amino acids)

>CSW01_07470 ABC transporter ATP-binding protein (Vibrio cholerae E7946 ATCC 55056)
MALITIHNGLLAFGDHPLLDHADFALQENERVCLVGRNGAGKSTLMKVLAGEILLDDGKM
QVMQDVVVSRLEQDPPRNQAGTVFDYVSGGLQGIGEQLKIYQDQLDLVATDPSESNINKL
AHIQEQLEVSGAWRFEDRIKNVLGSLKLDGHTKLTDLSGGWQRKAALARALACDPDVLLL
DEPTNHLDVTTIEWLEGFLKDFRGSIIFISHDRAFIKSMATRIVDLDRGQLSSFPGDYEN
YLTEKEEMLRVEELQNAEFDKKLAQEEVWIRQGIKARRTRNEGRVRALKRLRQERSERRE
VQGKVNLQIDDSNRSGKIVFEAENLHYSIGGKTIVDGFSFNIMRGDRIALIGPNGCGKST
LLKILLGDLQPDSGKVHCGTKLEVAYFDQYRELLDPEKTVIDNLADGKQEVMVGGRLRHA
LSYLQDFLFSPKRARTPVKALSGGEKNRLLLARILLKANNLLVLDEPTNDLDIETLELLE
ELLANYQGTLLLVSHDREFVDNTVTSSWIFEGDGKIEEFVGGYHDAQQQRAQVLQSRAAE
NIVKKEKVVEESPKSAPSKTKQKKLSYKLQRELEALPQRLEELEVEIAALQDIVNSPDFF
SQPVDKTQPILDKLTATEQELEIAFERWEELEAMQQESE