Protein Info for CSW01_07070 in Vibrio cholerae E7946 ATCC 55056

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details PF25917: BSH_RND" amino acids 70 to 285 (216 residues), 46.5 bits, see alignment E=6.7e-16 PF25973: BSH_CzcB" amino acids 71 to 284 (214 residues), 30.7 bits, see alignment E=6.2e-11 PF25881: HH_YBHG" amino acids 102 to 213 (112 residues), 30.8 bits, see alignment E=7.6e-11 PF25885: HH_EMRA" amino acids 140 to 215 (76 residues), 43.4 bits, see alignment E=1e-14 PF25876: HH_MFP_RND" amino acids 146 to 209 (64 residues), 38 bits, see alignment E=4.2e-13

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to vch:VC1410)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>CSW01_07070 HlyD family secretion protein (Vibrio cholerae E7946 ATCC 55056)
MKQQNLNRLSSMNSNNSNTEFDGVRAAQSRKKGFLGLAAAIVVAGGSYALYWHFIGSRYI
STDNAYAAAEIAEVTPAVGGIIAQVNVVDTEYVKQGDVLVQLDDTDARLALLQAEADLAL
AKRRVRSYLANDEGLSAMVEAQEANEQRVKAQLKAAQADFERAKIDLSRREDLVRSGSVS
GEELTNAKTGFAQAQANLNAAKAAMAQAQATKLSTIGSQKANAALTDNTTVDSNPEVLLA
KARYEQAKIDLERTVIRAPISGIVAKRQVQVGRRVQVGMPLMTVVPTDHIYVDANFKEVE
LRDVKVGQPVTLTADLYGDDVTYHGVVAGFSGGTGSAFSMIPAQNATGNWIKVVQRLPIR
IELDPKDLQAYPLQVGLSMVATIDTAGTTDPQTLVQYRAAKVSEQG