Protein Info for CSW01_06835 in Vibrio cholerae E7946 ATCC 55056

Annotation: BAX inhibitor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 164 to 181 (18 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details PF01027: Bax1-I" amino acids 19 to 221 (203 residues), 194.6 bits, see alignment E=9.5e-62

Best Hits

Swiss-Prot: 100% identical to Y1358_VIBCH: Uncharacterized membrane protein VC_1358 (VC_1358) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06890, (no description) (inferred from 100% identity to vcj:VCD_002983)

Predicted SEED Role

"Putative TEGT family carrier/transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>CSW01_06835 BAX inhibitor protein (Vibrio cholerae E7946 ATCC 55056)
MNTPMFTRTSSLERTLETNKVLKNTYFLLSMTLVTSAIAAMATMAIGISPIVALVMQLAA
IGILFFVMPKAINSSSGLVWTFVFTGLMGGALGPMLNFYAAMPNGPIVIAQALGLTGMVF
LGLSAYTITSKKDFSFMRNFLFAGLIIVIVAALINIFVGSTVAHLAISSVSALVFSGFIL
FDTSRIVRGEETNYISATISMYLNILNLFTSLLSILGIMNNND