Protein Info for CSW01_06820 in Vibrio cholerae E7946 ATCC 55056

Annotation: ribosomal RNA large subunit methyltransferase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 PF17785: PUA_3" amino acids 5 to 68 (64 residues), 65.1 bits, see alignment E=5.9e-22 PF10672: Methyltrans_SAM" amino acids 161 to 378 (218 residues), 86.5 bits, see alignment E=2.7e-28 PF03602: Cons_hypoth95" amino acids 210 to 309 (100 residues), 34.5 bits, see alignment E=2.5e-12

Best Hits

Swiss-Prot: 100% identical to RLMI_VIBC3: Ribosomal RNA large subunit methyltransferase I (rlmI) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 100% identity to vcj:VCD_002986)

MetaCyc: 63% identical to 23S rRNA m5C1962 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11602 [EC: 2.1.1.191]

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.191

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>CSW01_06820 ribosomal RNA large subunit methyltransferase I (Vibrio cholerae E7946 ATCC 55056)
MTPAIYLVKGRDKSLRRKHPWVFSRGISKVEGTPKLGETVDVYSFEGKWLAKAAYSPHSQ
ITARVWSFEQEPIDRDFFIKRIEQAQLLRNDIIERDGLTGYRLIAAESDGLPGITIDKYQ
DYLVCQLLSAGAEYQKQTLVEALLHCFPECHIYERSDVAVRKKEGLDERVGVLHGELPPK
SVVIEENGVKISVDIVGGHKTGFYLDQRDSRFQSMKYVKEKEVLNCFSYTGGFGLYALKG
GAKRVINADVSQPALDTAKFNAELNGFDISKKRAVFLNADVFKLLREYRDQGTRFDVVVM
DPPKFAESKAQLDGACRGYKDINMLAMQILNPGGTLLTYSCSGLMDQVLFQKIIADAALD
AGRDVKFVERFEQAADHPTDTAYPEGFYLKGFACKVL