Protein Info for CSW01_06790 in Vibrio cholerae E7946 ATCC 55056

Annotation: maleylacetoacetate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 2 to 79 (78 residues), 57 bits, E=4.9e-19
• TIGR01262: maleylacetoacetate isomerase
  • amino acids 5 to 214 (210 residues), 313.5 bits, E=3.3e-98
• PF13417: GST_N_3
  • amino acids 6 to 84 (79 residues), 52.1 bits, E=1.7e-17
• PF13409: GST_N_2
  • amino acids 12 to 80 (69 residues), 45.2 bits, E=2.9e-15
• PF14497: GST_C_3
  • amino acids 129 to 203 (75 residues), 26.1 bits, E=2.1e-09
• PF00043: GST_C
  • amino acids 141 to 201 (61 residues), 22.6 bits, E=2.5e-08

Best Hits

Swiss-Prot: 100% identical to MAAI_VIBCH: Probable maleylacetoacetate isomerase (maiA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01800, maleylacetoacetate isomerase [EC: 5.2.1.2] (inferred from 98% identity to vco:VC0395_A0964)

MetaCyc: 46% identical to glutathione transferase subunit (Escherichia coli B)
Glutathione transferase. [EC: 2.5.1.18]

Predicted SEED Role

"Maleylacetoacetate isomerase (EC 5.2.1.2) @ Glutathione S-transferase, zeta (EC 2.5.1.18)" (EC 2.5.1.18, EC 5.2.1.2)

MetaCyc Pathways

• L-tyrosine degradation I (5/5 steps found)
• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450
• Styrene degradation
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18, 5.2.1.2

Use Curated BLAST to search for 2.5.1.18 or 5.2.1.2

Protein Sequence (215 amino acids)

>CSW01_06790 maleylacetoacetate isomerase (Vibrio cholerae E7946 ATCC 55056)
MMSLILYGYWRSSAAYRVRIALNIKQLVYESRAVHLSREGGEQHHAEFHRLNPSELIPVL
IDGELCLNQSLAIIEYLDETYPAPRLIPERGAERYQVKALALDIAADIHPINNLRILQYL
TAKLGVADEEKNRWYRHWIDKGFQGLEEKLRHTAGEYCVGNRLSLVDVCLVPQVYNAERF
DLDMSRYPTLQQIAARLRALPAFAQAAPENQPDAC