Protein Info for CSW01_06765 in Vibrio cholerae E7946 ATCC 55056

Annotation: DNA mismatch repair protein MutT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 197 to 218 (22 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 295 to 313 (19 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 376 to 393 (18 residues), see Phobius details amino acids 405 to 423 (19 residues), see Phobius details amino acids 430 to 452 (23 residues), see Phobius details PF00293: NUDIX" amino acids 19 to 97 (79 residues), 46.8 bits, see alignment E=3.1e-16 PF01569: PAP2" amino acids 228 to 340 (113 residues), 29.4 bits, see alignment E=6.3e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A0958)

Predicted SEED Role

"Membrane-associated phospholipid phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>CSW01_06765 DNA mismatch repair protein MutT (Vibrio cholerae E7946 ATCC 55056)
MGLSFSALSSQEEEAAYRGALCLIRGDHKLVMTQEVLTGKLSLPGGTIEAGETPQMAAQR
ETWQETGMVVSVGRLIGQTSTAVVYECVSESQVIAYSYQNGFGGYELPIWFAPDYGVETV
SAMLVNPSFIKAEQYRYPEQWSFIADLFKLSQEQAVDYVAELHKAAPQFQQVELEWLGQL
QHGVAQLKKSMPWLQNLILSGMIFNLPVVALVLFPLLYWQLGKPYCYKILFAMSVTSLLC
LVAQQGFALPRPHVYQPALELFPSYGFAFPNLPIALWSCLGVLVWHVQQEFTQRWVMRVW
VGLFAWLSFASFYSGSAFLSDLATGALVGALVAWHIIRLDLKPGVNVESLLCSKSVWWGL
TVACVILAIIWPQPIFTQWLALLVTISGLVTLLTPSSSTLSLRGVLLMIALLLLADQGIS
LLIEPFNHSSFYMLVGETLRYPVLILLFVLLARRGLKAPIVSSTY