Protein Info for CSW01_06720 in Vibrio cholerae E7946 ATCC 55056

Annotation: tripartite tricarboxylate transporter TctB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 103 to 119 (17 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 150 to 167 (18 residues), see Phobius details PF07331: TctB" amino acids 39 to 174 (136 residues), 55.5 bits, see alignment E=3.6e-19

Best Hits

KEGG orthology group: K07794, putative tricarboxylic transport membrane protein (inferred from 100% identity to vcm:VCM66_1288)

Predicted SEED Role

"Tricarboxylate transport protein TctB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>CSW01_06720 tripartite tricarboxylate transporter TctB family protein (Vibrio cholerae E7946 ATCC 55056)
MFTRLFSPLPFTNPMELDMSDLPTKIFTKENLLCRDRVGAMLFLLFTLGYGYQTSLITMF
PGDELEPFNARTLPTILTYAGIGLSLLLLVVGQPDKKSGAVLEFNWKLLIGFLVLMALYG
LGLTYLGFVLATSFFLLAGFYLLGERRKSILFGASFPFVLAFYLLLTKGLDVYLEPGHLF
TFG