Protein Info for CSW01_06660 in Vibrio cholerae E7946 ATCC 55056

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details PF00672: HAMP" amino acids 156 to 207 (52 residues), 33.9 bits, see alignment 4.9e-12 PF00512: HisKA" amino acids 215 to 276 (62 residues), 49.9 bits, see alignment E=4.1e-17 PF02518: HATPase_c" amino acids 321 to 429 (109 residues), 87.1 bits, see alignment E=1.7e-28

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to vch:VC1319)

Predicted SEED Role

"Sensory histidine kinase in two-component regulatory system with RstA" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>CSW01_06660 two-component sensor histidine kinase (Vibrio cholerae E7946 ATCC 55056)
MRRIYIESLVSLIVLFFGSLVSYSFIVYELDTDYDYVLEDYQAEALQTLLSQIRQLDSPE
SAKTALRGYAEHIHKTVDLLPLTELPPEVQQHFSSEAAHSPIFHDDDRNLWLQLDSNEQI
YLLKPDSHSPVYQAIDRADNLLFVFMLGGFALYCMFLIWFLSRRLRELERVTHDFANGNL
QARASTKSSKSVGKLNHSFNMMADKISHLILSNKALTNAIAHDLRTPIFRIQWQAEVLAE
SQLNAKQQQQVASIIEDTEEMETMVDELLYYAKLEHPESDIQSQYLEVNQWLADFIDEQS
HKSSLQIQYLPSLQPLMLDADPQLLTRALVNLIRNAEKYAGDRLLIEASTVDAKLCIAIH
DNGPGIEEQHWPHIFDAFYSTDSSRNKAQSGFGLGLAIVKQIMARHQGEVTLTKSPLGGA
CFSLWLPLYPNKLELPVNKQ