Protein Info for CSW01_06485 in Vibrio cholerae E7946 ATCC 55056

Annotation: PTS lactose/cellobiose transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 PF02255: PTS_IIA" amino acids 6 to 98 (93 residues), 120.5 bits, see alignment E=1.3e-39

Best Hits

Swiss-Prot: 52% identical to PTQA_ECOLI: PTS system N,N'-diacetylchitobiose-specific EIIA component (chbA) from Escherichia coli (strain K12)

KEGG orthology group: K02759, PTS system, cellobiose-specific IIA component [EC: 2.7.1.69] (inferred from 100% identity to vch:VC1283)

MetaCyc: 52% identical to N,N'-diacetylchitobiose-specific PTS enzyme IIA component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-155B [EC: 2.7.1.196]

Predicted SEED Role

"PTS system, cellobiose-specific IIA component (EC 2.7.1.69)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.196 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (111 amino acids)

>CSW01_06485 PTS lactose/cellobiose transporter subunit IIA (Vibrio cholerae E7946 ATCC 55056)
MEQELIVMEIICNAGEARSLCYEALRLARTRSFEQAEEKLCQAKECLNRAHLIQTQLIEA
DQGEGKVPMTLVMVHAQDHLMTTILAQEMATEMVALHKHLAGEEAKCLEMH