Protein Info for CSW01_06450 in Vibrio cholerae E7946 ATCC 55056

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 203 to 226 (24 residues), see Phobius details PF08269: dCache_2" amino acids 38 to 191 (154 residues), 130.8 bits, see alignment E=1.5e-41 PF17200: sCache_2" amino acids 46 to 192 (147 residues), 145.3 bits, see alignment E=3.5e-46 PF17201: Cache_3-Cache_2" amino acids 75 to 192 (118 residues), 42.1 bits, see alignment E=1.7e-14 PF07730: HisKA_3" amino acids 250 to 315 (66 residues), 45.4 bits, see alignment E=2.5e-15 PF02518: HATPase_c" amino acids 355 to 446 (92 residues), 50.8 bits, see alignment E=5.4e-17

Best Hits

KEGG orthology group: K02480, two-component system, NarL family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to vco:VC0395_A0895)

Predicted SEED Role

"Sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>CSW01_06450 histidine kinase (Vibrio cholerae E7946 ATCC 55056)
MPLKAKLILLALLPLLIATASISWISIHQAKTLGQREIEIFRAKLMEERETSLKDSVEVA
FDAVRLIANNPNLSEAEAKQQVKAVLTNIRYGSDGYFFAYDAQGTNLVHPIQPELVGQNL
WQLQDERGDFLIQALLFQAQSGGGYHQYLWRKPSSGETVPKLSYSAWLDDWEWMIGTGLY
IEDLSHEVEKMQAAVNANIDTTFFSVVVILIVTVAVIIVLTLAINLHEHRLADKNLKDLV
HKTVLFQEDEKKHLARELHDGINQLLVSSKCHLELLANQLNDPKQIVHLEKSQHSLMTAI
NEVRRISHHLRPSALDDLGLQAALTTLLEDFKLHSQMEIEMLFDTQPGKLKSEVATTLYR
VVQESLNNIEKHAKAEKVTVLLQQMGDMLQLMVRDDGVGFSSKEALQKRGIGLRNMRERV
EFIGGEFELSSEPQLGTEITVLLKLDGSVYG