Protein Info for CSW01_06350 in Vibrio cholerae E7946 ATCC 55056

Annotation: bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 21 to 239 (219 residues), 291.2 bits, see alignment E=2.2e-91 PF02353: CMAS" amino acids 43 to 172 (130 residues), 37.7 bits, see alignment E=7.5e-13 PF01209: Ubie_methyltran" amino acids 52 to 162 (111 residues), 37.4 bits, see alignment E=8.9e-13 PF08003: Methyltransf_9" amino acids 53 to 165 (113 residues), 24.9 bits, see alignment E=4.7e-09 PF05175: MTS" amino acids 57 to 131 (75 residues), 27.7 bits, see alignment E=9.7e-10 PF13489: Methyltransf_23" amino acids 62 to 207 (146 residues), 90.3 bits, see alignment E=5.7e-29 PF06325: PrmA" amino acids 62 to 164 (103 residues), 28.1 bits, see alignment E=7.2e-10 PF13847: Methyltransf_31" amino acids 62 to 170 (109 residues), 64.6 bits, see alignment E=4.5e-21 PF13649: Methyltransf_25" amino acids 65 to 158 (94 residues), 69.1 bits, see alignment E=2.2e-22 PF08241: Methyltransf_11" amino acids 66 to 162 (97 residues), 76.6 bits, see alignment E=9.9e-25 PF08242: Methyltransf_12" amino acids 66 to 160 (95 residues), 60.7 bits, see alignment E=9.3e-20

Best Hits

Swiss-Prot: 100% identical to UBIG_VIBCH: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 100% identity to vco:VC0395_A0876)

MetaCyc: 72% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>CSW01_06350 bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase (Vibrio cholerae E7946 ATCC 55056)
MASIDLASTPLTATQNVDPNEIKKFEDMASRWWDLEGEFKPLHQINPLRLNYVLEKANGL
FGKRVLDVGCGGGILAESMAREGAQVTGLDMGKEPLEVARLHALETGTKLTYIQSTVEAH
AEANPHTYDVVTCMEMLEHVPDPLSVIQSCAKLVKPGGHVFFSTLNRNVKSYLFAIVGAE
KLLKIVPEGTHDHNKFIRPSELLKMVDHTALQEQGITGLHYNPFTDTYRLGSNVDVNYIV
HTRLF