Protein Info for CSW01_06305 in Vibrio cholerae E7946 ATCC 55056

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details PF08269: dCache_2" amino acids 35 to 184 (150 residues), 90.3 bits, see alignment E=3.2e-29 PF17200: sCache_2" amino acids 42 to 183 (142 residues), 92.4 bits, see alignment E=6.7e-30 PF17201: Cache_3-Cache_2" amino acids 66 to 179 (114 residues), 38 bits, see alignment E=3.2e-13 PF00672: HAMP" amino acids 204 to 254 (51 residues), 44.6 bits, see alignment 3.7e-15 PF00015: MCPsignal" amino acids 323 to 501 (179 residues), 144.7 bits, see alignment E=6.8e-46

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to vcm:VCM66_1203)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (536 amino acids)

>CSW01_06305 methyl-accepting chemotaxis protein (Vibrio cholerae E7946 ATCC 55056)
MLKLENIKVSYKLAAIVIVGIVGFLSLLFISANALKENLVAEREARLKAVIQSTLSQVAY
LNQTLPKEQAQEQAKALINALRFDGNNYMFVIDESRYTVVHPIRQDLVGQQMGNPGKDTE
GQFWFTMIDLARNGQQGSLIYPWKNQQGNPADKLSFVNGFAPWGWILGSGMLLDDIEHAV
YQQFLRMGFATLIVTLVMIGLGVVISRAVIQPLDTIKDVMKKVAQGDLTAQIPVLGKDEL
GIVAQRINNSIAAVHDALVESVQSASSVAEAAIRIASSAEETSQAVVSQRDQLSQLATAM
NQMTATVADVAGHAEDTARDTLDASKEANLGDKDVHSSVDSIRALSVELGVATDQVNKLK
EGVMQISEVTSVISGISEQTNLLALNAAIEAARAGDQGRGFAVVADEVRNLASRTHHSTD
EIQTMINRLQQLAVSTASAMQKSQALAANSVATAENAGSDLSLIVNHIQHVSDKATQIAT
AAEEQSAVAEEMNRNVSGINDAALEMSQAATYLAEESEKLADLSRQLDQKLTAFKL