Protein Info for CSW01_06285 in Vibrio cholerae E7946 ATCC 55056

Annotation: vitamin B12 ABC transporter permease BtuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 242 to 267 (26 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details PF01032: FecCD" amino acids 29 to 330 (302 residues), 267.9 bits, see alignment E=5.5e-84

Best Hits

Swiss-Prot: 100% identical to BTUC_VIBCH: Vitamin B12 import system permease protein BtuC (btuC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06073, vitamin B12 transport system permease protein (inferred from 99% identity to vco:VC0395_A0864)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>CSW01_06285 vitamin B12 ABC transporter permease BtuC (Vibrio cholerae E7946 ATCC 55056)
MNDKMDFHRLLQHKQQRWQRSSYLLIGLFLSVCVLYLLVGELWLSPFSAWSSLEQQLVWE
LRLPRLLAAAVIGASLAVAGATLQVLLGNVLAEPGVVGVSGGASVAMVILLLFFPSLNSP
VAFMAAAVLGALLFTLLLVVMARKLRLTTARLLLVGVALGILSGAVVTWAFYFSDDLGLR
QLMYWLMGSVAGVSWYQHLLSLVAVPVVIWLVLQGGVLDKLMLGEGHAKQLGIDIHRVRW
RLILAIALLVGASVALGGVIGFVGLVVPHLLRLTLGSENRLLLPLSALCGALLLVSADLI
ARLALGSGELPLGVVTTTLGAPIFIWMLVRNHDSC