Protein Info for CSW01_06240 in Vibrio cholerae E7946 ATCC 55056

Annotation: exodeoxyribonuclease I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF00929: RNase_T" amino acids 11 to 191 (181 residues), 84.5 bits, see alignment E=2e-27 PF08411: ExoI_SH3" amino acids 210 to 352 (143 residues), 197.8 bits, see alignment E=1.3e-62 PF26016: ExoI_C" amino acids 360 to 472 (113 residues), 131.1 bits, see alignment E=3.7e-42

Best Hits

Swiss-Prot: 59% identical to EX1_ECOLI: Exodeoxyribonuclease I (sbcB) from Escherichia coli (strain K12)

KEGG orthology group: K01141, exodeoxyribonuclease I [EC: 3.1.11.1] (inferred from 100% identity to vco:VC0395_A0855)

MetaCyc: 59% identical to exodeoxyribonuclease I (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"Exodeoxyribonuclease I (EC 3.1.11.1)" in subsystem DNA Repair Base Excision (EC 3.1.11.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>CSW01_06240 exodeoxyribonuclease I (Vibrio cholerae E7946 ATCC 55056)
MQQEHQPTFFFFDYETWGVNPAKDRPSQFAGVRTDMDFNIIGEPLVIYCQLPNDYLPAPE
AALITGITPQKANSQGLAEPEFIARIHAELSTPNTINLGYNSIRFDDEVTRYTCYRNFID
PYAWSWQHGNSRWDLLDVLRACHALRPEGIEWPENDDGFTSFKLEHLSVANGIEHSNAHD
AMADVIATIELAKKVKAAQPKLFDYFFTMRHKRKLTELIDIVNQTPLMHVSGMLGRERHY
TSWIVPIAWHPTNQNAVIVVDLGKDPQPLLELDAETLQARLYTRYEDLAPDELPVPVKLV
HLNKCPILAPAKTLTAENAQKIGIDREQCLAHLNVIRQHPEIREKLVTVFSQEREFNQES
DVDSQLYAGFFSPADRAAMEIIRTTAPENLGSLAIRVADKRIEPLLFRYRARHYPHTLTD
TEQRRWAAHCRDYFERNLEGYMLNLENLVHEHQADPKKMAILKSVYHYVEKLAC