Protein Info for CSW01_06230 in Vibrio cholerae E7946 ATCC 55056

Annotation: LrgB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details PF04172: LrgB" amino acids 6 to 218 (213 residues), 250.8 bits, see alignment E=4.9e-79

Best Hits

Swiss-Prot: 51% identical to YOHK_ECOLI: Inner membrane protein YohK (yohK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to vco:VC0395_A0853)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>CSW01_06230 LrgB family protein (Vibrio cholerae E7946 ATCC 55056)
MWLIITLGVFFVARWVAQKCTTPLANPLLISIGILIPLLTYLKVPFETYYADNQWLSYLL
QPAVVALAYPLYEQLPQIRANWRIIALACGVGSVMSMITASLIAVSMGADIELIAALMGK
SVTTPIAMEVARQLGGEPAIAAILVLLVGLFGAILAYPIYKLLNITHPIAKGLTMGTVSH
ALGTATCAEKDPRDAAFSSLALVVCGVITSVLAPSLFAFALWLQ