Protein Info for CSW01_06170 in Vibrio cholerae E7946 ATCC 55056

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR02481: hemerythrin-like metal-binding domain" amino acids 5 to 131 (127 residues), 101.1 bits, see alignment E=4.7e-33 PF01814: Hemerythrin" amino acids 12 to 130 (119 residues), 51.8 bits, see alignment E=1.8e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 202 to 366 (165 residues), 173.1 bits, see alignment E=4e-55 PF00990: GGDEF" amino acids 207 to 364 (158 residues), 155.1 bits, see alignment E=2e-49

Best Hits

KEGG orthology group: K07212, GGDEF domain K07216, hemerythrin (inferred from 100% identity to vcm:VCM66_1171)

Predicted SEED Role

"GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>CSW01_06170 GGDEF domain-containing protein (Vibrio cholerae E7946 ATCC 55056)
MQSFKWDQYFETGLEEVDEQHQSLVNIVNRYSSLLAENHVSLDEIRLALFELSRYSEYHF
KEEEKLMREVGISALHLEEHIQVHRTFMSEVFSMQAFIHDVDDRSAVQLLEFLIHWLAYH
ILGIDQNMARQVIAIRSGMSAEEAYAKEEREKNAATEPLLNALNALFDQVSERNRELVKL
NQSLEEKVIERTQQLYQVNRQLEALSMTDSLTGLPNRRKAMRQLVLHWNLAQDNQQPFVC
VMIDIDGFKAVNDHHGHDVGDKVLTTIANMLRDHFRSDDLVCRLGGDEFLVICPETNTAG
GVYIAEQVCRAIQQQVISLENNIRWQGSVSMGVAAFASNMKDHHELLRAADQAVYLAKNS
GKNRVCAFGAPS