Protein Info for CSW01_06140 in Vibrio cholerae E7946 ATCC 55056

Annotation: excinuclease ABC subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 TIGR00194: excinuclease ABC subunit C" amino acids 11 to 589 (579 residues), 705.6 bits, see alignment E=2.7e-216 PF01541: GIY-YIG" amino acids 18 to 93 (76 residues), 44.4 bits, see alignment E=5.8e-15 PF27096: UvrC_M" amino acids 102 to 193 (92 residues), 81.4 bits, see alignment E=2e-26 PF02151: UVR" amino acids 210 to 238 (29 residues), 35.7 bits, see alignment (E = 1.9e-12) PF22920: UvrC_RNaseH" amino acids 252 to 370 (119 residues), 107.3 bits, see alignment E=1.6e-34 PF08459: UvrC_RNaseH_dom" amino acids 386 to 542 (157 residues), 164.4 bits, see alignment E=7.1e-52 PF14520: HHH_5" amino acids 557 to 609 (53 residues), 42.4 bits, see alignment 2.9e-14

Best Hits

Swiss-Prot: 100% identical to UVRC_VIBCH: UvrABC system protein C (uvrC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to vch:VC1214)

MetaCyc: 64% identical to UvrABC excision nuclease subunit C (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (610 amino acids)

>CSW01_06140 excinuclease ABC subunit C (Vibrio cholerae E7946 ATCC 55056)
MSTQFDSAPFLKTVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLTSYFRKNLDSEKTKALV
SNIAKIDVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLSAHKHPRLSSHRG
AKKRRGEYFGPYPDSGAVRETLHLIQKIFPVRQCEDTVYSNRTRPCLMYQIGRCAGPCVK
GLISDQGYQEIVHYLRLFLQGKDNQVLSILVEKMEQASRELRFEDAAKARDQIQAIRRVQ
EQQFVSDDSLEDLDVLGFAQENGIACIHILMIRQGKVLGSRSHFPKIPSDTSQVEVFESF
LSQYYLSHSEARSIPARIILNRGLTEETEALQIAISELAGRKVTFHVNPTGTRGRYLKLA
NTNALTAITTKMNHKMTISQRFKALQEELGMDAITRMECFDISHTMGESTMASCVVFNQE
GPLKQEYRRYNITGITGGDDYAAMAQVLERRYSKQLDSSKIPDIIFIDGGKGQLNRAYEI
ISSCWQDWPKYPKIIGIAKGVTRKPGLETLITIDGDEFHLPSDAPALHLIQHIRDESHNH
AIAGHRAQRGKTRRTSTLEGIEGVGPKRRQALLKYLGGMQELKRASVEEIAKVPGISHAL
AENIYQALKQ