Protein Info for CSW01_05995 in Vibrio cholerae E7946 ATCC 55056

Annotation: cysteine desulfurase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR01976: cysteine desulfurase family protein" amino acids 6 to 408 (403 residues), 629.6 bits, see alignment E=1.4e-193 PF00266: Aminotran_5" amino acids 28 to 404 (377 residues), 229.4 bits, see alignment E=1.4e-71 PF00155: Aminotran_1_2" amino acids 70 to 205 (136 residues), 22.3 bits, see alignment E=1.4e-08 PF01053: Cys_Met_Meta_PP" amino acids 111 to 236 (126 residues), 30.9 bits, see alignment E=2.2e-11 PF01041: DegT_DnrJ_EryC1" amino acids 113 to 212 (100 residues), 27.7 bits, see alignment E=3.4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to vch:VC1184)

Predicted SEED Role

"CBSS-345074.3.peg.1627: Cysteine desulfurase (EC 2.8.1.7)" (EC 2.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>CSW01_05995 cysteine desulfurase-like protein (Vibrio cholerae E7946 ATCC 55056)
MVAMRFTPESVRQQFPALAQIVNDKPVVFFDGPGGSQVPQSVLDAMVAYLGRYNANLGGH
YFSSKKTVELVQSAREHVQALLNASTPESIVFGANMTSLTFQFSRAISRDWRVGDEVIVT
ALDHYSNVSSWQQAAQDKGAIVHQARVNTADCTLDQAHLLSLINPRTRLVAVTFASNTTG
SLVELEAIIEAAHQVGAMVYVDAVHYLPHHLPDVQALGCDFLACSAYKFFGPHVGIVYVA
PQWQNTILPYKVEPATNQGPGRFETGTLSFEGLAGVIAVVQYLAQWGDPNSRLRERLVES
YQQYQQHEQRLSEYFLQKLSDMPALKLHGLQLADAAKRTPTFALTCTDCTPQSMAKMLGE
QNVCVWNGHFYALGLVRQLGLESSGGVLRIGLMHYNTTEEIDHLFALLRDGLPQLA