Protein Info for CSW01_05940 in Vibrio cholerae E7946 ATCC 55056

Annotation: anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02885: Glycos_trans_3N
  • amino acids 3 to 64 (62 residues), 72.2 bits, E=2.4e-24
• TIGR01245: anthranilate phosphoribosyltransferase
  • amino acids 5 to 330 (326 residues), 423.9 bits, E=2.4e-131
• PF00591: Glycos_transf_3
  • amino acids 72 to 322 (251 residues), 343.1 bits, E=1.1e-106

Best Hits

Swiss-Prot: 100% identical to TRPD_VIBC3: Anthranilate phosphoribosyltransferase (trpD) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 100% identity to vcm:VCM66_1127)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Protein Sequence (332 amino acids)

>CSW01_05940 anthranilate phosphoribosyltransferase (Vibrio cholerae E7946 ATCC 55056)
MQTIINKLYEQQGLTQAESQQLFDQIIRGEMDPVLMAAVLTALKIKGETPDEIAGAAKAL
LANANPFPRPDYDFADIVGTGGDGSNTINISTTAAFVAAACGVKVAKHGNRGVSSKSGSS
DLLSSFGINLAMSAQDSRQALDDLGVAFLFAPQYHGGVRHAMPVRQTMKTRTIFNILGPL
INPARPNIELMGVYSKDLVRPIAQTMLQMGLKRAAVVHGSGLDEVAIHGETQVAEIRQGE
LIEYTLTPEDFGVSRYPLDAIRGGEPEENRAIITQILTGNGTAAQMAAVAVNVALLLRLF
GQEDLKANTQQAIAVMKSGQAYGLVQQLAQRG