Protein Info for CSW01_05920 in Vibrio cholerae E7946 ATCC 55056

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 39 to 66 (28 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 150 to 167 (18 residues), see Phobius details amino acids 192 to 220 (29 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 265 to 281 (17 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 332 to 350 (19 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details PF00375: SDF" amino acids 15 to 403 (389 residues), 378.4 bits, see alignment E=2.1e-117

Best Hits

KEGG orthology group: None (inferred from 100% identity to vch:VC1168)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>CSW01_05920 dicarboxylate/amino acid:cation symporter (Vibrio cholerae E7946 ATCC 55056)
MEVLKTKGLLNNIGVQVVIAMLAGTAVGAAMGHDATLFAPLGAIFINLIKMLVIPLVAVA
LISGAAGLGDSHSAGKVGAVTLSYFAITSAAAVALALIMGELFQPGVGVDVSGVESMFSS
EYAAQGELPTFWATIIGMIPTNVFQSLNEANILQILVFCLFLGIAISKQAKEKRDPVINA
VNTIVDAMVWMINKVMLIAPIGVFGLMADAVGTFGFSALMVVFKLFVVYVAAIAIFGFVA
YPVMIQLFSKTSAKKFIQAMKKPQAVALSTASSMATLPVTMDTVKNDLGVRNSTASFVLP
LGATINMSGNAIYYGLVAIFFAQLFNIDLSMGAYIAIIVTATLGAVGQAGVPGPSFLVVA
VLLSAGIPIEGLPLLFALDRIFDMIRTALNITGDAACAVIVDSMITEEAAAELEKREA