Protein Info for CSW01_05900 in Vibrio cholerae E7946 ATCC 55056

Annotation: carboxy-S-adenosyl-L-methionine synthase CmoA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR00740: tRNA (cmo5U34)-methyltransferase" amino acids 4 to 242 (239 residues), 393.2 bits, see alignment E=2.4e-122 PF00891: Methyltransf_2" amino acids 52 to 173 (122 residues), 29.5 bits, see alignment E=1.4e-10 PF01209: Ubie_methyltran" amino acids 54 to 164 (111 residues), 22.3 bits, see alignment E=2.2e-08 PF13847: Methyltransf_31" amino acids 56 to 165 (110 residues), 30.4 bits, see alignment E=9.6e-11 PF13649: Methyltransf_25" amino acids 60 to 158 (99 residues), 52.7 bits, see alignment E=1.8e-17 PF08241: Methyltransf_11" amino acids 62 to 162 (101 residues), 47.5 bits, see alignment E=6.9e-16 PF08242: Methyltransf_12" amino acids 62 to 160 (99 residues), 43.5 bits, see alignment E=1.3e-14

Best Hits

Swiss-Prot: 100% identical to CMOA_VIBCM: Carboxy-S-adenosyl-L-methionine synthase (cmoA) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to vco:VC0395_A0733)

MetaCyc: 72% identical to carboxy-S-adenosyl-L-methionine synthase (Escherichia coli K-12 substr. MG1655)
RXN0-7066

Predicted SEED Role

"tRNA (uridine-5-oxyacetic acid methyl ester) 34 synthase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>CSW01_05900 carboxy-S-adenosyl-L-methionine synthase CmoA (Vibrio cholerae E7946 ATCC 55056)
MNPKDTLFSAPIDKIGDFTFDERVAEVFPDMIQRSVPGYSNIISAIGMLAERFVKPHSKI
YDLGCSLGAATLSMRRHIKQEGCQIIAVDNSAAMVERCKLHLNAYRSDTPVQVIEADIRD
IAIENASVVVLNFTLQFLAPDDRYALLEKIYAGLRPGGILILSEKFVFSDQEAHELLIDL
HHDFKRANGYSELEISQKRSAIENVMRPDSIQTHKQRFATLGFSSFEVWFQCFNFGSMFA
IK