Protein Info for CSW01_05895 in Vibrio cholerae E7946 ATCC 55056

Annotation: tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08003: Methyltransf_9
  • amino acids 7 to 322 (316 residues), 569 bits, E=7.1e-175
• TIGR00452: tRNA (mo5U34)-methyltransferase
  • amino acids 9 to 321 (313 residues), 484.2 bits, E=6.5e-150
• PF13489: Methyltransf_23
  • amino acids 112 to 270 (159 residues), 45.8 bits, E=1.8e-15
• PF13847: Methyltransf_31
  • amino acids 124 to 228 (105 residues), 39 bits, E=2e-13
• PF13649: Methyltransf_25
  • amino acids 126 to 205 (80 residues), 38.1 bits, E=6.3e-13
• PF08242: Methyltransf_12
  • amino acids 127 to 221 (95 residues), 35.2 bits, E=5.1e-12
• PF08241: Methyltransf_11
  • amino acids 127 to 224 (98 residues), 35.6 bits, E=3.5e-12

Best Hits

Swiss-Prot: 100% identical to CMOB_VIBCM: tRNA U34 carboxymethyltransferase (cmoB) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to vcm:VCM66_1118)

MetaCyc: 63% identical to tRNA U34 carboxymethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-7067

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

MetaCyc Pathways

• 5-(methoxycarbonylmethoxy)uridine biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (323 amino acids)

>CSW01_05895 tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB (Vibrio cholerae E7946 ATCC 55056)
MFNFANVYQQIAQHPQLQLWLNTLPQQLTDWQAKQHGDLDRWMRNLKKIPVGQPEVIDLK
NAVAAHNHQPLAQGEQKKLEAVLKTFHPWRKGPYHLHGIHIDTEWRSDWKWDRLLPHISP
LKNRLVLDVGCGNGYHMWRMLGEGAQQVFGIDPSELFLIQFEAVRKLLGDDQRVHLLPLG
IEQMPELNAFDTVFSMGVLYHRRSPLDHLLQLKNQLVAGGELILETLVVEGDEHTVLVPF
DRYAQMRNVYFFPSALALKVWLEKTGFVDVRIVDENITSLGEQRTTEWMTHNSLPDYVDP
QDPSKTIEGYPAPRRAILIAKKP