Protein Info for CSW01_05830 in Vibrio cholerae E7946 ATCC 55056

Annotation: putative pyridoxal-dependent aspartate 1-decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 TIGR03799: putative pyridoxal-dependent aspartate 1-decarboxylase" amino acids 7 to 527 (521 residues), 957.9 bits, see alignment E=5.9e-293 PF00282: Pyridoxal_deC" amino acids 64 to 442 (379 residues), 180.3 bits, see alignment E=7.7e-57 PF01212: Beta_elim_lyase" amino acids 209 to 422 (214 residues), 41.9 bits, see alignment E=1.2e-14 PF00266: Aminotran_5" amino acids 212 to 361 (150 residues), 23 bits, see alignment E=5.6e-09

Best Hits

Swiss-Prot: 73% identical to PANP_ALIF1: Aspartate 1-decarboxylase (panP) from Aliivibrio fischeri (strain ATCC 700601 / ES114)

KEGG orthology group: K01580, glutamate decarboxylase [EC: 4.1.1.15] (inferred from 100% identity to vco:VC0395_A0719)

Predicted SEED Role

"Glutamate decarboxylase, eukaryotic type (EC 4.1.1.15)" (EC 4.1.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>CSW01_05830 putative pyridoxal-dependent aspartate 1-decarboxylase (Vibrio cholerae E7946 ATCC 55056)
MVSEHKSAQVNFDSLLKIFTVPEGPDSTLTKIDEELSRNLNHFLRKHIVAEEKPLKEIEK
DFSNAHIPEQPQFVSDHTQYLLDTLVSHSVHTASPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMIHRLIYGETDHFYQQWMHSAEHSLGAFCSGGTIANITA
LWVARNNALKAEGDFPGVEKAGLFKAMRHYGHEGLAILVSERGHYSLKKAADVLGIGQEG
LVAVKTDAHNRICPHDLEQKITELKANKIKVFAVVGVAGTTETGNIDPLRTIAQICQREQ
IHFHIDAAWGGATLMSNRYRGLLDGVELADSVTIDAHKQLYIPMGAGMVLFKDPNAMRSI
EHHAQYILRQGSKDLGSHTLEGSRSGMAMLVYASMHIISRPGYQLLIDQSIEKARYFADL
IDAQTDFELVSQPELCLLTYRYLPEHVRMALEKSQGVQRAQLNELLNELTKFIQKKQRET
GKSFVSRTQLNPHQWDKLATIVFRVVLANPLTTKEILHNVLDEQREIAQQAPKLMRQIEH
LTQCILNQ