Protein Info for CSW01_05725 in Vibrio cholerae E7946 ATCC 55056

Annotation: tRNA 2-thiouridine(34) synthase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF02540: NAD_synthase" amino acids 9 to 81 (73 residues), 32.5 bits, see alignment E=1.5e-11 PF02568: ThiI" amino acids 10 to 80 (71 residues), 27.2 bits, see alignment E=8.5e-10 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 12 to 368 (357 residues), 501.6 bits, see alignment E=5.1e-155 PF03054: tRNA_Me_trans" amino acids 12 to 210 (199 residues), 282.5 bits, see alignment E=5.7e-88 PF20259: tRNA_Me_trans_M" amino acids 216 to 280 (65 residues), 75.6 bits, see alignment E=5.3e-25 PF20258: tRNA_Me_trans_C" amino acids 292 to 368 (77 residues), 92 bits, see alignment E=7.2e-30

Best Hits

Swiss-Prot: 100% identical to MNMA_VIBCH: tRNA-specific 2-thiouridylase MnmA (mnmA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 100% identity to vcj:VCD_003214)

MetaCyc: 78% identical to tRNA-specific 2-thiouridylase (Escherichia coli K-12 substr. MG1655)
RXN0-2023 [EC: 2.8.1.13]

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.- or 2.8.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>CSW01_05725 tRNA 2-thiouridine(34) synthase MnmA (Vibrio cholerae E7946 ATCC 55056)
MMSVEHSANSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEEYCTAAED
LADAQAVCDKLGIPLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEF
ADEVLDADYIAMGHYVRRTFPQNGEKPQMLRGLDGNKDQSYFLYTLSHEQVARTLFPVGE
LEKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLPAQPGKIETPEGKVIGEH
QGLMYHTLGQRKGLHIGGMKESSEQPWYVADKDLKRNVLIAVQGADHPLLKSHGLVAAQL
HWVDRTPITEPVRCSVKTRYRQSDIACTIIPLSDDRIKVMFDEPQVAVTPGQSAVFYQGE
ICLGGGIIEERI