Protein Info for CSW01_05700 in Vibrio cholerae E7946 ATCC 55056

Annotation: DUF2878 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 41 (17 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details PF11086: DUF2878" amino acids 4 to 150 (147 residues), 113.5 bits, see alignment E=5.6e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_1079)

Predicted SEED Role

"FIG024285: Hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>CSW01_05700 DUF2878 domain-containing protein (Vibrio cholerae E7946 ATCC 55056)
MALVAISLWFDLLWALAVLGQQTWLWLTTLLVVATYGLTAIQRHPLFEKMVWMAVVGIMI
DSSNMLLGLLTFADDQFPLWLVALWFAFTWYAGHLLPQLNQYSHTLLCLAGGVLGSLSYW
FGYRMGAVGWEYPTFIVMLALFLEWIGITWLLLKVMRHEKRTYNPIRFARERTWLRRRR