Protein Info for CSW01_05695 in Vibrio cholerae E7946 ATCC 55056

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF02353: CMAS" amino acids 158 to 425 (268 residues), 280.4 bits, see alignment E=4.5e-87 PF13489: Methyltransf_23" amino acids 202 to 324 (123 residues), 35.1 bits, see alignment E=3.2e-12 PF01135: PCMT" amino acids 203 to 265 (63 residues), 21.4 bits, see alignment E=5.9e-08 PF13649: Methyltransf_25" amino acids 219 to 313 (95 residues), 50.5 bits, see alignment E=8.2e-17 PF08241: Methyltransf_11" amino acids 220 to 317 (98 residues), 40.7 bits, see alignment E=9.5e-14 PF08242: Methyltransf_12" amino acids 220 to 314 (95 residues), 39.8 bits, see alignment E=1.9e-13

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 100% identity to vcm:VCM66_1078)

Predicted SEED Role

"S-adenosyl-L-methionine dependent methyltransferase, similar to cyclopropane-fatty-acyl-phospholipid synthase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>CSW01_05695 class I SAM-dependent methyltransferase (Vibrio cholerae E7946 ATCC 55056)
MPRFMRTQTKLRTIIRSNLMLNSSSMEISRSLTSWQKGARSIIHRALQYLEGNLTVIEHF
PDQTQTTHEQFGQDKPDAIHAVIEIKHPDFYSRVLKGGSIAAAEAYMEGWWESPNLTALM
QLMAANLGTLDKLESQSSPVTQWLNRFTHWLKRNTIDQAKDNIHQHYDLGNELYQLFLDE
EMLYSSALFTQPELSLEQAQQAKMQRLCEQLQLKPTDHVLEIGTGWGAMAIYMAQHYGCK
VTTTTISEEQYAYAQQKITALGLNNQITLLKQDYRLLSGQYDKLVSIEMIEAVGKAYLPT
FLSQCYALLKPRGKMAIQAITIADQRYESYSNNVDFIQKYIFPGGFLPSISVLTELATKR
TGLVLRNLHDIGIDYALTLQHWRDRFEQQLPKVRDLGYDERFIRMWRYYFCYCEGGFLAR
SISTVHMTFERD