Protein Info for CSW01_05645 in Vibrio cholerae E7946 ATCC 55056

Annotation: biotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR00433: biotin synthase" amino acids 15 to 310 (296 residues), 415.5 bits, see alignment E=5.8e-129 PF04055: Radical_SAM" amino acids 49 to 202 (154 residues), 80.1 bits, see alignment E=2.3e-26 PF06968: BATS" amino acids 220 to 310 (91 residues), 104.3 bits, see alignment E=3.1e-34

Best Hits

Swiss-Prot: 100% identical to BIOB_VIBC3: Biotin synthase (bioB) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 100% identity to vcj:VCD_003230)

MetaCyc: 71% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>CSW01_05645 biotin synthase (Vibrio cholerae E7946 ATCC 55056)
MEVRHNWTVAEVKALLDKPFMDLLFEAQQVHRLHHPHNHVQVSTLLSIKTGACPEDCKYC
PQSAHYRTDVDKERLMEVERVLDAAQKAKNSGSTRFCMGAAWKNPKERDMPLLKEMIRGV
KDMGLETCMTLGMLTPDQAQQLAQAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHV
RDAGMKICSGGIIGMGESTNDRAGLLVELANLPTHPESVPINMLVKVKGTPLEQVDDVEP
FDFVRLIAVARIMMPKSAVRLSAGREKMNEQMQALCFMAGANSIFYGCKLLTTPNPAEDS
DMLLFKKLGINREQVAQKPDEITENELLDRVVERVAARPTASDLFYDAAL