Protein Info for CSW01_05625 in Vibrio cholerae E7946 ATCC 55056

Annotation: outer membrane lipoprotein carrier protein LolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR00547: outer membrane lipoprotein carrier protein LolA" amino acids 5 to 197 (193 residues), 193.1 bits, see alignment E=1.9e-61 PF03548: LolA" amino acids 29 to 186 (158 residues), 184.3 bits, see alignment E=7.7e-59

Best Hits

Swiss-Prot: 100% identical to LOLA_VIBCH: Outer-membrane lipoprotein carrier protein (lolA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03634, outer membrane lipoprotein carrier protein (inferred from 100% identity to vco:VC0395_A0626)

MetaCyc: 40% identical to outer membrane lipoprotein carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Outer membrane lipoprotein carrier protein LolA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>CSW01_05625 outer membrane lipoprotein carrier protein LolA (Vibrio cholerae E7946 ATCC 55056)
MNKWLALLFCSFSAIAAPKDTLSERLAMSEGFSATFNQQVLSPEGKVILTGNGKVDIARP
SLFRWETETPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPFVLLTRNKASDWDAY
HVEEKGDVFTLTPTALDSNQGRFQITISEKGVVQGFKVIEQDGQQSEFTFSKVKQQKPNA
SVFNYKVPKGVEVDDQRN