Protein Info for CSW01_05600 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 58 to 85 (28 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 281 to 298 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 22 to 277 (256 residues), 87.9 bits, see alignment E=3.4e-29

Best Hits

KEGG orthology group: K05832, putative ABC transport system permease protein (inferred from 100% identity to vch:VC1102)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>CSW01_05600 ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MGYFNFCKQKGVCMSAFAFFGALELGLLYGLVALGVYLTFRVLDFPDLSVDGSFPMGAAV
AATAIVAGINPWVATGLAILAGAATGWVTAFLSVRCGILHLLASILTMIAAFSINIRIMG
RPNLALLGEDTILTPFEALGDPVLIRPLVVAVLVVISALLVIRLLNSDFGLGLRATGVNA
RMVAAQGASTAFYTYFCLALSNGFVGFAGALFAQTNSFADVTSGVGTIVVGLAAVILGQT
LIPGRKIWVAVVAVIVGSVLYRLAVAFALSSGMFGLQASDLNLVTAVLVALALIMPKIKR
NLKSKKRNAPAQKPEVSQQGSVSGDAV