Protein Info for CSW01_05530 in Vibrio cholerae E7946 ATCC 55056

Annotation: two-component system response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF00072: Response_reg" amino acids 13 to 120 (108 residues), 82.8 bits, see alignment E=3.1e-27 PF13487: HD_5" amino acids 206 to 371 (166 residues), 85.1 bits, see alignment E=7.6e-28 PF01966: HD" amino acids 219 to 334 (116 residues), 24.7 bits, see alignment E=3.6e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A0606)

Predicted SEED Role

"response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>CSW01_05530 two-component system response regulator (Vibrio cholerae E7946 ATCC 55056)
MQMDNMHDEKLNVLLLDDENDILKALNRVLRMDYNVVTFDNGADALEYLQENPIHIIISD
MRMPEMDGADFLAKAREMQPDTVRLLLTGYADIQSTVRAVNAGGIHTYISKPWDNENLKL
IVGKAAEFYRLSRDKERLTIELEERNKELEVANQALAENNHKLAQFNQELEAKVQERTVA
LQESNKRLESLLASRNKTFKDILAMVTAIIQHRTGFPADHAERIANQAKSVALKLKLSEA
VASHVYLCGLMHQIGLIAETSNDWKVVKVHQDSEIPITPNVNPILGAEIVGRIKRFEPLM
EIIRHQDELYDGTGKPDHLRGEQIPIGARIIKVVKDYDFFVAGANNPRRMHTKSAQGYLR
QQSEVYYDPKVVEAFITIVSAVTRIEEGMELCVSLSEVRPGMVIKRDIYLPNGNLMLTAG
NAMSEPLLRKLKELEQEMNMPIPVYIG