Protein Info for CSW01_05515 in Vibrio cholerae E7946 ATCC 55056

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF08448: PAS_4" amino acids 12 to 131 (120 residues), 28.4 bits, see alignment E=1.6e-10 PF02518: HATPase_c" amino acids 319 to 425 (107 residues), 97.6 bits, see alignment E=6.1e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to vch:VC1084)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>CSW01_05515 two-component sensor histidine kinase (Vibrio cholerae E7946 ATCC 55056)
MAKSRLLLSELLDQLSFALCIVRNDYVIVKVNEYFESRVIFDGETMQGKNILELFPESAD
YLKRKIDTALVIESSSFSSWEQKPHLLPFKSSRPVSGEEEQMYQNLEVIPIHSEDGTIEH
VCLCVYDVTIQASQQQELKRVSQKLEEEHQSQKVLIKKLEDAQGQLIQSEKMASIGQLSA
GIAHEINNPVGFITSNLQTLSDYFNSLEKVLKSITQTIGQSKDTALNEACQKILKQGQVD
FILEDTAELITESLEGSSRVMSIVKNLKEFSHVDRSEWSYANLENCIESTLKIINNEIKY
NITLEKHYAANVPDVFCQPMQINQVLLNILVNASHAIKGEGTITITLQSAGDDFVEIHIR
DTGCGIPEEIRERIFEPFFTTKPVGSGTGLGLSVSYGIINKHNGTISVTSEVGKGSEFTI
RLPVNPSAEAVDNTDAKAM