Protein Info for CSW01_05465 in Vibrio cholerae E7946 ATCC 55056

Annotation: CPBP family intramembrane metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 32 to 62 (31 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details PF02517: Rce1-like" amino acids 173 to 263 (91 residues), 72.8 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 100% identity to vcm:VCM66_1030)

Predicted SEED Role

"Putative membrane protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>CSW01_05465 CPBP family intramembrane metalloprotease (Vibrio cholerae E7946 ATCC 55056)
MLLSASALLWLPLALAIMAGFARYHRVSWGLLIITLLSALGSGYLTFVGAGIICVGFALA
YLAANGQSHWRTTAWVALLLWCLALFLHWLPGFSNLKVLDKVIASAHSTPFSLYLNLDKP
LVFFALLLAFPALLGQSKTANIKATLLTLVPLFALLPIAVWLGALAFEWSLPEWWWIFAL
NNLLFTCVAEEALFRGLIQQKAQQQFGAIAGLLIASALFGMAHFAGGPLLMIFAALAGLG
YGLVFHFTGRLWVSVGVHFLFNFAHLLFFTYPMLAR