Protein Info for CSW01_05365 in Vibrio cholerae E7946 ATCC 55056

Annotation: DNA polymerase III subunit gamma/tau

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 692 TIGR02397: DNA polymerase III, subunit gamma and tau" amino acids 3 to 355 (353 residues), 436.5 bits, see alignment E=4.1e-135 PF13177: DNA_pol3_delta2" amino acids 21 to 178 (158 residues), 153.6 bits, see alignment E=2.1e-48 PF00004: AAA" amino acids 42 to 171 (130 residues), 37.8 bits, see alignment E=1.1e-12 PF07728: AAA_5" amino acids 42 to 145 (104 residues), 23.4 bits, see alignment E=2.4e-08 PF22608: DNAX_ATPase_lid" amino acids 183 to 230 (48 residues), 79.6 bits, see alignment 5.4e-26 PF12169: DNA_pol3_gamma3" amino acids 233 to 357 (125 residues), 78 bits, see alignment E=2.9e-25 PF12168: DNA_pol3_tau_4" amino acids 478 to 549 (72 residues), 76.2 bits, see alignment E=9.7e-25 PF12170: DNA_pol3_tau_5" amino acids 551 to 689 (139 residues), 176.6 bits, see alignment E=1.4e-55

Best Hits

KEGG orthology group: K02343, DNA polymerase III subunit gamma/tau [EC: 2.7.7.7] (inferred from 100% identity to vcm:VCM66_1009)

Predicted SEED Role

"DNA polymerase III subunits gamma and tau (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (692 amino acids)

>CSW01_05365 DNA polymerase III subunit gamma/tau (Vibrio cholerae E7946 ATCC 55056)
MSYLALARKWRPTRFSEVVGQSHVLTALENALAQNRLHHAYLFSGTRGVGKTTIGRLFAK
GLNCETGITATPCGQCATCQEIDQGRFVDLLEIDAASRTKVEDTRELLDNVQYKPARGRF
KVYLIDEVHMLSRHSFNALLKTLEEPPEYVKFLLATTDPQKLPVTILSRCLQFHLKPISV
ENIQQQLDKVLHAEQISSDSKALNLLAHAADGSMRDALSLTDQAIALGNGVVKSDIVAHM
LGTLDTDHSLHLLQAISLQTPQAVMDCIETLAQNGVEWDGLLQQLSTQLHRIAMYQALPA
TLDKSLPEASRIESLAKTLAPQDVQLYYQIALKGRQDLPLSPTARIGIEMLMLRMMAFRP
SHVSLASVIVPPNTAVTAPTIAAPTSQMAAAAPQPQPVAQSNVSQSASQAMPHPVAPPMM
AAQPVVESAVPVTQREASHSINAPEASVVTNTDTQSQASMPALAGLRHQLRSKRQEVQNK
GADGKKSDATSATPASALERIAQRAQQVQVSPERNDEDELEPEEEIYQWRPMQPIEVAVK
SEVTPTQLKKALEHEKTPEMGAKLIEEAVAQDAWSALVQRLETAKMVEQLALNSAFVRQG
DQISLTLRPSHAHLHNEKAQQELEQALNHVLGEACSLNITVGQEGETPLELRERLYQQKL
TSALHSLQTDPNVQFIERRFNAQLDSDSVRPI