Protein Info for CSW01_05270 in Vibrio cholerae E7946 ATCC 55056

Annotation: iron-sulfur cluster carrier protein ApbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF10609: ParA" amino acids 118 to 361 (244 residues), 338.1 bits, see alignment E=7.7e-105 PF13614: AAA_31" amino acids 120 to 238 (119 residues), 36.8 bits, see alignment E=9.9e-13 PF09140: MipZ" amino acids 121 to 243 (123 residues), 30.4 bits, see alignment E=6.1e-11 PF01656: CbiA" amino acids 122 to 280 (159 residues), 43.9 bits, see alignment E=5.8e-15

Best Hits

Swiss-Prot: 40% identical to APBC_HELPJ: Iron-sulfur cluster carrier protein (mrp) from Helicobacter pylori (strain J99 / ATCC 700824)

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 100% identity to vcj:VCD_003305)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>CSW01_05270 iron-sulfur cluster carrier protein ApbC (Vibrio cholerae E7946 ATCC 55056)
MIPLSFSGFSCSLSGGSMGKKGEVMQSIQSKQDLCRWLSQFSHPDLISDWAMSPSIVTIT
PNQQVNVQLPFAAHSLLAELSDWIAKQQASGAVAPVTFDIQVKPQALETRVSAAVKGVKN
IIAVTSGKGGVGKSTTAVNLALAIAKSGGKVGLLDADIYGPSVPLMLGKTKAKPVVRDNK
WMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMPPGTG
DIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICSHCGE
KEHIFGVGGAQTLAAEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLALAQR
VCASLFWQGKAKPESIQIQWVN