Protein Info for CSW01_05220 in Vibrio cholerae E7946 ATCC 55056

Annotation: cyclic pyranopterin monophosphate synthase MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 TIGR00581: molybdenum cofactor biosynthesis protein C" amino acids 4 to 152 (149 residues), 235.7 bits, see alignment E=7.9e-75 PF01967: MoaC" amino acids 15 to 150 (136 residues), 200 bits, see alignment E=7.4e-64

Best Hits

Swiss-Prot: 100% identical to MOAC_VIBC3: Cyclic pyranopterin monophosphate synthase (moaC) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 100% identity to vcm:VCM66_0981)

MetaCyc: 81% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>CSW01_05220 cyclic pyranopterin monophosphate synthase MoaC (Vibrio cholerae E7946 ATCC 55056)
MSQLTHINASGEANMVDVSNKADTVREARAEAYVRMAPETLQLILSGQHHKGDVFATARI
AGIQAAKRTWELIPLCHPLLLSKVEVQLEALPEQSSVRIESLCKLSGKTGVEMEALTAAS
VAALTIYDMCKAVQKDIVIENVRLLEKSGGKSGHFKVDA