Protein Info for CSW01_05210 in Vibrio cholerae E7946 ATCC 55056

Annotation: GTP 3',8-cyclase MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 6 to 329 (324 residues), 340.6 bits, see alignment E=4.2e-106 PF04055: Radical_SAM" amino acids 19 to 180 (162 residues), 111.4 bits, see alignment E=7.9e-36 PF13353: Fer4_12" amino acids 23 to 125 (103 residues), 25.5 bits, see alignment E=2.2e-09 PF06463: Mob_synth_C" amino acids 186 to 312 (127 residues), 131.7 bits, see alignment E=2.3e-42

Best Hits

Swiss-Prot: 100% identical to MOAA_VIBCM: GTP 3',8-cyclase (moaA) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to vcj:VCD_003316)

MetaCyc: 64% identical to GTP 3',8'-cyclase (Escherichia coli K-12 substr. MG1655)
RXN-8340 [EC: 4.1.99.22]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>CSW01_05210 GTP 3',8-cyclase MoaA (Vibrio cholerae E7946 ATCC 55056)
MAQQFEDRFQRKFYYLRLSITDVCNFKCTYCLPDGYKPSAGRPASFLTVNEIRRVVSAFA
HCGTSKVRITGGEPSLRKDFGEIIHTIAQTPGIQKVATTTNGYRLAKHIGEWREAGLTQL
NVSVDSLDPRMFAQITGENRFQQVMSGIDRAFEVGFEQVKVNVVLMKNLNHLELPQFMAW
IKTRPIQLRFIELMQTGEMDALFARHHVSGISIRDYLFGNGWLLKARADNDGPAQVFIHP
DFQGEIGLIMPYEKDFCRSCNRLRVSALGKLHLCLFGEQGIELRDLLQDDHQENALIERI
QTQLQNKAETHFLHDGNSGVTPHLASIGG