Protein Info for CSW01_05195 in Vibrio cholerae E7946 ATCC 55056

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 PF00072: Response_reg" amino acids 2 to 108 (107 residues), 90.4 bits, see alignment E=2.6e-29 PF14532: Sigma54_activ_2" amino acids 133 to 303 (171 residues), 77 bits, see alignment E=5.5e-25 PF00158: Sigma54_activat" amino acids 133 to 298 (166 residues), 235 bits, see alignment E=1.2e-73 PF07728: AAA_5" amino acids 156 to 282 (127 residues), 27.1 bits, see alignment E=1.1e-09 PF25601: AAA_lid_14" amino acids 304 to 382 (79 residues), 67.1 bits, see alignment E=3.1e-22 PF02954: HTH_8" amino acids 404 to 442 (39 residues), 42.3 bits, see alignment 1.5e-14

Best Hits

Swiss-Prot: 100% identical to LUXO_VIBCH: Regulatory protein LuxO (luxO) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K10912, two-component system, repressor protein LuxO (inferred from 100% identity to vcj:VCD_003319)

Predicted SEED Role

"Regulatory protein LuxO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>CSW01_05195 sigma-54-dependent Fis family transcriptional regulator (Vibrio cholerae E7946 ATCC 55056)
MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLY
AVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKN
DVDNKNQNYQGFIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRG
DKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDLDL
QTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHL
PPLRARGDDVIEIAYSLLGFMSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVV
VLNEGREITLDMLPPPLNQMSAPINRALPLAHENKVSVHEIFPLWMTEKQAIEQAIEACD
GNIPRAATYLDVSPSTIYRKLQTWNEKVKEKEKER