Protein Info for CSW01_05185 in Vibrio cholerae E7946 ATCC 55056

Annotation: excinuclease ABC subunit UvrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 676 TIGR00631: excinuclease ABC subunit B" amino acids 5 to 669 (665 residues), 1079 bits, see alignment E=0 PF04851: ResIII" amino acids 14 to 87 (74 residues), 37.1 bits, see alignment E=9.6e-13 PF17757: UvrB_inter" amino acids 159 to 250 (92 residues), 109.7 bits, see alignment E=1.9e-35 PF00271: Helicase_C" amino acids 439 to 546 (108 residues), 70.3 bits, see alignment E=5e-23 PF12344: UvrB" amino acids 553 to 594 (42 residues), 75.5 bits, see alignment 6.6e-25 PF02151: UVR" amino acids 636 to 671 (36 residues), 31.2 bits, see alignment 4e-11

Best Hits

Swiss-Prot: 88% identical to UVRB_VIBPA: UvrABC system protein B (uvrB) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 100% identity to vcj:VCD_003320)

MetaCyc: 79% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (676 amino acids)

>CSW01_05185 excinuclease ABC subunit UvrB (Vibrio cholerae E7946 ATCC 55056)
MSKAFELVSDYQPAGDQPTAIKQLLEGLEAGLAHQTLLGVTGSGKTFTLANVIATAQRPT
IILAPNKTLAAQLYGEMKAFFPNNAVEYFVSYYDYYQPEAYVPTTDTFIEKDASVNAHIE
QMRLSATKALLERKDAVIVASVSAIYGLGDPDSYLKMMLHLRRGDVINQRDMLRRLAELQ
YSRNDMAFERGQFRVRGEVIDIFPAESDQEAVRVEMFDDEIECISLFDPLTGVITSRDLA
RFTIYPKTHYVTPRERILEAIEQIKSELQVRRQYLLDNNKLLEEQRISQRTQFDIEMMNE
LGFCSGIENYSRYLSGRAEGEPPPTLFDYLPHDGLLIIDESHVTVPQIGAMFKGDRSRKE
TLVEFGFRLPSALDNRPLKFDEFEALAPQTIFVSATPSEYELTKSGGEVAEQVVRPTGLL
DPIIEVRPVATQVDDLLSEARIRAANDERILVTTLTKRMAEDLTEYLHEHGVKVRYLHSD
IDTVERVEIIRDLRLGVFDVLVGINLLREGLDMPEVALVAILDADKEGFLRSERSLIQTM
GRAARNVNGKAILYADSITKSMRKAIDETERRREKQLAYNEQRGITPQPLKRSVKDIMEL
GDIAKSRKQKNSKVVPLAKVAEESAAYQVLTPQQLEKEISKLEAAMYQHAQNLEFELAAQ
KRDEIHQLRQQFIANS