Protein Info for CSW01_05160 in Vibrio cholerae E7946 ATCC 55056

Annotation: electron transport complex subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details PF03116: NQR2_RnfD_RnfE" amino acids 5 to 347 (343 residues), 393 bits, see alignment E=5.3e-122 TIGR01946: electron transport complex, RnfABCDGE type, D subunit" amino acids 8 to 348 (341 residues), 489.4 bits, see alignment E=2.8e-151

Best Hits

Swiss-Prot: 100% identical to RNFD_VIBCH: Ion-translocating oxidoreductase complex subunit D (rnfD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03614, electron transport complex protein RnfD (inferred from 100% identity to vcj:VCD_003324)

Predicted SEED Role

"Electron transport complex protein RnfD" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>CSW01_05160 electron transport complex subunit D (Vibrio cholerae E7946 ATCC 55056)
MAFFIASSPHLRSKRSTADVMRWVLACALPGLIAQTYFFGYGTLIQLLLAISVAVALEAG
IMLLRKRSPISALRDYSAVVTAWLLAVAIPPLSPWWVVVIGLIFAIVIAKHLYGGLGQNP
FNPAMIAYVVLLISFPVQMTSWMAPIKLTAEPSSLVDSFSLIFGGFDSDGLSLQQIRTGI
DGITMATPLDAFKTSLKAGHTMSETLTQPQFSGFAGIGWEWVNIAYLLGGLILLKLRIIR
WHIPMAMLAGLVFTALLAQLFAPGTTASPMIHLLSGATMLGAFFIATDPVSASTTDKGRL
IYGFFIGAMVFLIRSWGGFPDGVAFAVLLANMCVPLIDYYTKPRTYGH