Protein Info for CSW01_05150 in Vibrio cholerae E7946 ATCC 55056

Annotation: electron transport complex subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details TIGR01948: electron transport complex, RnfABCDGE type, E subunit" amino acids 6 to 209 (204 residues), 298.8 bits, see alignment E=8.2e-94 PF02508: Rnf-Nqr" amino acids 7 to 200 (194 residues), 218.7 bits, see alignment E=2.9e-69

Best Hits

Swiss-Prot: 100% identical to RNFE_VIBCM: Ion-translocating oxidoreductase complex subunit E (rnfE) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K03613, electron transport complex protein RnfE (inferred from 100% identity to vcj:VCD_003326)

Predicted SEED Role

"Electron transport complex protein RnfE" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>CSW01_05150 electron transport complex subunit E (Vibrio cholerae E7946 ATCC 55056)
MNENRTLMLNGMWNNNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVTVSLVR
DYVPKEVRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS
KNDVLPAALDGFWMGLGMTSVLVVLGSLREIIGNGTLFDGADLLLGEWAKVLRIEVFHFD
SAFLLALLPPGAFIGVGFLIAAKSVIDKQTAARQPKQQKQAIERARVTNV