Protein Info for CSW01_05070 in Vibrio cholerae E7946 ATCC 55056

Annotation: N-acetylglucosamine-6-phosphate deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00221: N-acetylglucosamine-6-phosphate deacetylase
  • amino acids 1 to 374 (374 residues), 522.4 bits, E=3.2e-161
• PF01979: Amidohydro_1
  • amino acids 51 to 374 (324 residues), 139.4 bits, E=1.8e-44

Best Hits

Swiss-Prot: 100% identical to NAGA_VIBCH: N-acetylglucosamine-6-phosphate deacetylase (nagA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01443, N-acetylglucosamine-6-phosphate deacetylase [EC: 3.5.1.25] (inferred from 100% identity to vco:VC0395_A0515)

MetaCyc: 100% identical to N-acetylglucosamine-6-phosphate deacetylase subunit (Vibrio cholerae non-O1)
N-acetylglucosamine-6-phosphate deacetylase. [EC: 3.5.1.25]

Predicted SEED Role

"N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.1.25)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (20/22 steps found)
• peptidoglycan recycling I (13/14 steps found)
• N-acetylglucosamine degradation II (3/3 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (5/6 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• chitin derivatives degradation (6/8 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (2/4 steps found)
• N-acetyl-D-galactosamine degradation (2/5 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.25

Use Curated BLAST to search for 3.5.1.25

Protein Sequence (378 amino acids)

>CSW01_05070 N-acetylglucosamine-6-phosphate deacetylase (Vibrio cholerae E7946 ATCC 55056)
MYALTNCKIYTGNDVLVKHAVIINGDKIEAVCPIESLPSEMNVVDLNGANLSPGFIDLQL
NGCGGVMFNDEITAETIDTMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKYPN
QSLGLHLEGPYLNVMKKGIHSVDFIRPSDDTMIDTICANSDVIAKVTLAPENNKPEHIEK
LVKAGIVVSIGHTNATYSEARKSFESGITFATHLFNAMTPMVGREPGVVGAIYDTPEVYA
GIIADGFHVDYANIRIAHKIKGEKLVLVTDATAPAGAEMDYFIFVGKKVYYRDGKCVDEN
GTLGGSALTMIEAVQNTVEHVGIALDEALRMATLYPAKAIGVDEKLGRIKKGMIANLTVF
DRDFNVKATVVNGQYEQN