Protein Info for CSW01_04975 in Vibrio cholerae E7946 ATCC 55056

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF13411: MerR_1" amino acids 1 to 67 (67 residues), 65.2 bits, see alignment E=7.3e-22 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 1 to 127 (127 residues), 212.1 bits, see alignment E=1.1e-67 PF00376: MerR" amino acids 2 to 39 (38 residues), 47.7 bits, see alignment E=1.6e-16 PF09278: MerR-DNA-bind" amino acids 45 to 107 (63 residues), 65.5 bits, see alignment E=8e-22

Best Hits

Swiss-Prot: 100% identical to CUER_VIBC3: HTH-type transcriptional regulator CueR (cueR) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K11923, MerR family transcriptional regulator, copper efflux regulator (inferred from 100% identity to vch:VC0974)

Predicted SEED Role

"HTH-type transcriptional regulator cueR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>CSW01_04975 transcriptional regulator (Vibrio cholerae E7946 ATCC 55056)
MNISQIAKLTSLTAKSIRLYEEKGLIIPPLRSESGYRTYTQQHVDDLLLIARCRRVGFSL
DECKAMLTLANDPNRTSAAVRARAQEKWQEISRKLSELTMIKQQLEEWIASCPGDQGSDC
PIIEQLKGHCCSNNKTKTP