Protein Info for CSW01_04895 in Vibrio cholerae E7946 ATCC 55056

Annotation: apolipoprotein N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 14 to 46 (33 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 478 to 499 (22 residues), see Phobius details PF20154: LNT_N" amino acids 19 to 179 (161 residues), 137.2 bits, see alignment E=6e-44 TIGR00546: apolipoprotein N-acyltransferase" amino acids 61 to 453 (393 residues), 328.2 bits, see alignment E=4.3e-102 PF00795: CN_hydrolase" amino acids 222 to 472 (251 residues), 146.9 bits, see alignment E=7.1e-47

Best Hits

Swiss-Prot: 100% identical to LNT_VIBCH: Apolipoprotein N-acyltransferase (lnt) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03820, apolipoprotein N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to vch:VC0958)

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (505 amino acids)

>CSW01_04895 apolipoprotein N-acyltransferase (Vibrio cholerae E7946 ATCC 55056)
MNSVLSHRLMRPLAAAFVGVITPLAFAPYQFWPLALLSPFILLLLLHQQSAKRAALIAYL
WGIGQFAVGISWVHVSIDTFGGMPKIASLFLMTLLVGYLALYPSLFGWLLNRLFPNNSRS
KWLCAAPALWLITDWLRGWVMTGFPWLWLGYSQIDSPLANFAPIGGVELITLLLLFCAGS
LAYAVLNRRWLMACIPLVVYATGYGLQAMQWVTPQTERTASLALIQGNIEQGLKWLPSQR
WPTIMKYTDLTRENWDADVIIWPEAAIPAFEYEISSFLHNLDAAARMNQSAVITGIINQS
DDKQYFNSVLTVGDTPHGEYRYDLTQRYHKYHLLPFGEFVPFEEILRPLAPFFNLPMSSF
SQGAYVQPNLIAKGFAFVTALCYEIIFNEQVRDNVTPDTDFLLTLSNDAWFGRSIGPLQH
MEIARMRALELGKPLIRATNNGVTAVTDERGRIMAQLPQFETGVLKATVTPTRGSTPYFL
WGTTPLYLWVGLAAGFAFWRQRRAR