Protein Info for CSW01_04870 in Vibrio cholerae E7946 ATCC 55056

Annotation: ribosome silencing factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 TIGR00090: ribosome silencing factor" amino acids 8 to 104 (97 residues), 120.8 bits, see alignment E=1.1e-39 PF02410: RsfS" amino acids 11 to 104 (94 residues), 111 bits, see alignment E=1.5e-36

Best Hits

Swiss-Prot: 62% identical to IOJAP_ECOLI: Ribosomal silencing factor RsfS (rsfS) from Escherichia coli (strain K12)

KEGG orthology group: K09710, ribosome-associated protein (inferred from 100% identity to vcm:VCM66_0908)

Predicted SEED Role

"Iojap protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>CSW01_04870 ribosome silencing factor (Vibrio cholerae E7946 ATCC 55056)
MQGEALKDFLFDKADDMKAVDIVTLDVKEKSSVTDYMIVCTGTSKRHVASIAEHVANEAK
LSGLQPLGMNGENEGEWVVLDMGSVMLHVMQEAPRELYQLEKLWG