Protein Info for CSW01_04800 in Vibrio cholerae E7946 ATCC 55056

Annotation: chain-length determining protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 737 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 449 to 469 (21 residues), see Phobius details PF02706: Wzz" amino acids 12 to 101 (90 residues), 42.6 bits, see alignment E=1.3e-14 PF13807: GNVR" amino acids 397 to 468 (72 residues), 38.7 bits, see alignment E=1.6e-13 TIGR01007: capsular exopolysaccharide family" amino acids 520 to 723 (204 residues), 153.6 bits, see alignment E=2.5e-49 PF13614: AAA_31" amino acids 548 to 681 (134 residues), 48.3 bits, see alignment E=2.4e-16 PF01656: CbiA" amino acids 548 to 712 (165 residues), 29.5 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_003398)

Predicted SEED Role

"Capsular polysaccharide synthesis enzyme CpsD, exopolysaccharide synthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (737 amino acids)

>CSW01_04800 chain-length determining protein (Vibrio cholerae E7946 ATCC 55056)
MTGKQFTQEEVIDIRQYFNVLLNYKWRILLFSVMVTAITLLFVLSMRSEYTARATILIES
TQAKAVSIEEVYGLDTKSQEYYLTQIEILKSDTIAQEVIERLDLASDPEFDLSPESDASP
SLKERLVEWMPFLQGFKQEETVADPDLEAYRQNRLILYKFKRGMEISPIRKTQLVNIYYT
AGDPKLAAKIANEIARVYMDSHLEAKLEVELKANTWLNTRMEELRTQLRESEAKLQAFLQ
AEGLVDVQGVEGLATQELEELTSQMNKARDRRVAAETLYQVANSYSKNDSDLTALSSIPE
ISNHPTIRDLKVAEVDAERKVSEFSKRYGPKHPKLKSASAQLEAVRKNLRAELRQLLNGI
NNELQAAKQSERSLQTEFNQRKSEFQTLTVKNAKYSELKREVQTNRELFDLFLARQKETS
ASGDFNTTIARFTDQASAPLTPSKPNKKLIVLLAFVVSFGFACVVAFIADAMTDTFADIK
QVEKQLALSLLGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVV
MLTSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGT
QSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAV
SDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGY
YHYQAYYGEETKSGAAK