Protein Info for CSW01_04785 in Vibrio cholerae E7946 ATCC 55056

Annotation: undecaprenyl-phosphate glucose phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 17 to 35 (19 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 22 to 465 (444 residues), 509.8 bits, see alignment E=8.8e-157 TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 26 to 465 (440 residues), 584.1 bits, see alignment E=2.8e-179 PF13727: CoA_binding_3" amino acids 63 to 239 (177 residues), 175.8 bits, see alignment E=8.7e-56 PF02397: Bac_transf" amino acids 275 to 458 (184 residues), 232.7 bits, see alignment E=2.2e-73

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 100% identity to vch:VC0934)

Predicted SEED Role

"Capsular polysaccharide synthesis enzyme CpsA, sugar transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>CSW01_04785 undecaprenyl-phosphate glucose phosphotransferase (Vibrio cholerae E7946 ATCC 55056)
MMKEKSRIRITNYHGKFFYRLIDSIFILVIMYISIKSNQHVVTMSYISVALLGVLFYSYI
AESLDIYSGWRTAKLRSLSLHTAFCWAATIASLTLLAYFSKTGIEFSRMVMGAWFVGSFI
GLIGWRVLAFATIHYMHKKGLHTKNAVIIGMTTQGQELSNNLLKNPELGIVMQGFYDDRA
PERLKEGAPVLGNINDALSLAKTGQVQNVYIALPMQAQRRINQILDAFSDSTVNTYIVPD
FFTFNLLHSRWYTIGDVNAFSIFDTPFNGLLNWVKRFEDLVLSSLILLLISPVLLAVAIG
VKLSSPGPIIFKQNRYGLDGKPIQVWKFRSMRVMDNGSHVQQATKGDPRVTRFGAFIRRT
SLDELPQFFNVLQGSMSIVGPRPHAVAHNEQYRTIVNRYMLRHKVKPGITGWAQINGWRG
ETDTLDKMEKRVQFDLDYIHRWSLWFDLKIVFLTIFKGFVGKNAY