Protein Info for CSW01_04690 in Vibrio cholerae E7946 ATCC 55056

Annotation: MexH family multidrug efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 34 to 339 (306 residues), 328.3 bits, see alignment E=2.1e-102 PF25973: BSH_CzcB" amino acids 59 to 184 (126 residues), 33.4 bits, see alignment E=1.2e-11 PF25917: BSH_RND" amino acids 59 to 180 (122 residues), 43.8 bits, see alignment E=6.5e-15 PF25876: HH_MFP_RND" amino acids 93 to 152 (60 residues), 26.8 bits, see alignment E=1.8e-09 PF25944: Beta-barrel_RND" amino acids 191 to 264 (74 residues), 24.3 bits, see alignment E=1.2e-08 PF25954: Beta-barrel_RND_2" amino acids 192 to 263 (72 residues), 63.7 bits, see alignment E=5.4e-21 PF25967: RND-MFP_C" amino acids 272 to 328 (57 residues), 40.3 bits, see alignment E=8.8e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_0870)

MetaCyc: 100% identical to vibriobactin efflux pump periplasmic adaptor protein (Vibrio cholerae O1 biovar El Tor str. N16961)
TRANS-RXN-502

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>CSW01_04690 MexH family multidrug efflux RND transporter periplasmic adaptor subunit (Vibrio cholerae E7946 ATCC 55056)
MNKNTVLSLTLLTLLMNSAVLSAKEPNQPPAISVVTESVQSQQISQSLSVVGKLKAEQSV
DIAAEVAGKVDMIAVQANQQVKKGQILIKLDDDKAQAALVEAKAYLQDEQRKLTEYERLL
KRNAITPTEIDAQRARVEIGQARLNAAQANLADLHITAPFDGTVGFIDFSRGKWVSAGSE
LLTLDNLSLMRLDLQIPERYLPQLSKGMKVQGSSEAWPNVQFEGSVVAVDSRINQETLNL
RVRVHFPNPDQRLKPGMLMSARIHFPAISAPIIPVQALEYSGTKRFVYVIGEDNVAKRRE
VSLGARVENQVVIEKGLQIGEKIVVQGIVNMRDNARVSEVTVEGRPLKKDDK