Protein Info for CSW01_04415 in Vibrio cholerae E7946 ATCC 55056

Annotation: molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 TIGR02349: chaperone protein DnaJ" amino acids 5 to 351 (347 residues), 463.4 bits, see alignment E=3e-143 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 96.4 bits, see alignment E=1.6e-31 PF01556: DnaJ_C" amino acids 122 to 335 (214 residues), 182.1 bits, see alignment E=1.5e-57 PF00684: DnaJ_CXXCXGXG" amino acids 149 to 209 (61 residues), 61.4 bits, see alignment E=1.6e-20 PF27439: DnaJ_C_2" amino acids 341 to 378 (38 residues), 40.5 bits, see alignment 4.6e-14

Best Hits

Swiss-Prot: 100% identical to DNAJ_VIBCH: Chaperone protein DnaJ (dnaJ) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 100% identity to vcm:VCM66_0813)

MetaCyc: 74% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>CSW01_04415 molecular chaperone DnaJ (Vibrio cholerae E7946 ATCC 55056)
MSKRDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSGDAGAAEKFKEVKEAYEILTDA
QKKAAYDQYGHAAFEQGAGGFGGGGFGGGGADFGDIFGDVFGDIFGGGRRGGGPRAQRGS
DLRYNMELSLEEAVRGCSKEIEVPTLVHCDACDGSGAKKGTSAQTCGTCHGHGQVQMRQG
FFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLSGEGEAG
EMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRVSLKVPA
ETQTGRMFRMRGKGVKGVRSAALGDLIVKLVVETPVNLSARQKELLKEFEESCGGEAATK
HKPKAEGFFNGVKKFFDDLTS